PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0380s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Trihelix
Protein Properties Length: 345aa    MW: 39295.2 Da    PI: 4.8128
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0380s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix32.13e-1067144279
             trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstc 79 
                          Wt +  l L++    +e + +++ +  ++W  +s+++    ++r+ +qC+ kw++l  +y +ik++e++    ++s +
  Cagra.0380s0001.1.p  67 WTVKDCLILVNEIAAVEADCSNALSSFQKWTMISENCNILDVRRTLNQCRRKWDSLLSDYNQIKKWESRYGGSARSYW 144
                          99999999999999*****************************************************99754444455 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138377.4E-966146No hitNo description
PROSITE profilePS500906.63267123IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MLKSSSFSFV CLEHPRMHLD SSTNFISDLC GTVLFLFSMV KNSSCIFRMD EGSSGSRRLR  60
SQVAPDWTVK DCLILVNEIA AVEADCSNAL SSFQKWTMIS ENCNILDVRR TLNQCRRKWD  120
SLLSDYNQIK KWESRYGGSA RSYWSLSTEK RKLLNLPGNV DNELFESINA VVMIQDDKAG  180
TESDSDPEAQ DLVDVTTELD FVGSKRSRQR TTVTKEIPQQ KTKKKEPQTY RVQENTQQKP  240
TKATHQNINM EEKKKTVEEI STDEEEEETM NIEEDVEVME VMEAKLSYKI DLIHAIAGRN  300
LAKDNDTGDD ISINDKLKYG RQQGDELISC LSEIVNTLSR LREV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1204209KRSRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284107.10.0hypothetical protein CARUB_v10005240mg
TrEMBLR0GXI90.0R0GXI9_9BRAS; Uncharacterized protein
STRINGAT4G31270.11e-163(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121542328
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.11e-141sequence-specific DNA binding transcription factors